Basic Information | |
---|---|
Taxon OID | 3300019885 Open in IMG/M |
Scaffold ID | Ga0193747_1010771 Open in IMG/M |
Source Dataset Name | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2206 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → environmental samples → Firmicutes bacterium CAG:170 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.8925 | Long. (o) | -106.9111 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034691 | Metagenome / Metatranscriptome | 174 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193747_10107712 | F034691 | AGTAGG | LGTLLVALIVSFTAVTVVLAGIFAAYGAVTGILYAFAYGSRQRTTRTTMLVPSQSQASGD |
⦗Top⦘ |