NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193729_1009422

Scaffold Ga0193729_1009422


Overview

Basic Information
Taxon OID3300019887 Open in IMG/M
Scaffold IDGa0193729_1009422 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4455
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9225Long. (o)-106.9538Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014781Metagenome / Metatranscriptome260Y
F018803Metagenome / Metatranscriptome233Y
F019720Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0193729_10094222F018803GAGMVANEDRPHSMPTLLTPPTLERVLQGLYDSKIRCGVQNEPLVGGITAWIDYGRRTEKATSCGTIVGDRQVWPAADRIAAWMNETALRLFPENPYAKEHSTEAPAGPSRRGNFAIK
Ga0193729_10094225F014781AGAAGMESREDCLREAAECDRLAQLANTQGTRTLLAVAAFQWRKLAERAGERQKRSWPLMPDAVRMN
Ga0193729_10094226F019720GGAGMKLLARIGAPFAWKVVRQHDGYTYFENSITGRRRCHWTGSVWGHIDYKFMRSGDVSYGPFGRQVY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.