NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194032_1005272

Scaffold Ga0194032_1005272


Overview

Basic Information
Taxon OID3300019938 Open in IMG/M
Scaffold IDGa0194032_1005272 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1401
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027356Metagenome / Metatranscriptome195Y
F027832Metagenome / Metatranscriptome193N
F051561Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
Ga0194032_10052722F051561GAGGMSIDFDEEFDLLKALREAQALEMVEETDNGWQTKVVPDALSQRAAKEIVDLRQQVNELRNRLADKSID
Ga0194032_10052724F027356GAGGMKINGIHMNARGEPVDRFDLEDAIMKAWHTTDDIKAFYTSAENMNEDQVINALMGLEIFAEMRFNELWNTYEQCISNGVFSDSTTRGAEIAQSLDEAIESFGQEKL
Ga0194032_10052725F027832N/AIEHVPSEKDRSYNELVCSICHCEFDIELEGGIDGYLGVLPVAMCAMCYSGLDEFFTQLHGCYDDEHDGYEDHNED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.