NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193755_1068865

Scaffold Ga0193755_1068865


Overview

Basic Information
Taxon OID3300020004 Open in IMG/M
Scaffold IDGa0193755_1068865 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1145
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9763Long. (o)-107.0041Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012292Metagenome / Metatranscriptome282Y
F063996Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0193755_10688651F063996AGGAVKKQYFFAYLFVRAAKGLALLVILIGVGFCVLRYYQASIAAGAVAYQSSSHLQQALDRLKAAFLATEQIIDSFNAGHQSKIPNFQAPRFPLVIDSENDFARISAELSRVDHERHQLKESIVSRFENLVESIEEKLHAYAAVLQSSPSPTPATGQNLISNATPWPTSREESLFSSQLGSSDANERSANLKER
Ga0193755_10688652F012292N/AVEPEVKSRMITDFKEQTQAVLSRVGDATGNFPEIDRLDSVQQLPPPVSESVASLIDRARDFRAKVGYETALSECRSETETVDALSAVDQSTRNIAGNDASAANSGLTDFLKDNPEPMVDTQRPLWRYLTSMRLLCSRLEKEAEIHLERAGAFASAGRTGDAIREYQEAYRTFPNPATAEKIRQLQRNSLGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.