NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193726_1000216

Scaffold Ga0193726_1000216


Overview

Basic Information
Taxon OID3300020021 Open in IMG/M
Scaffold IDGa0193726_1000216 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)78749
Total Scaffold Genes80 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)65 (81.25%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9871Long. (o)-107.0011Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002473Metagenome / Metatranscriptome556Y
F003836Metagenome / Metatranscriptome466Y
F044041Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0193726_100021651F044041AGGAGGMLLAEVKELCDQLREVIAAGPGKNDLALQEATGIVSMLQQAAPWNGPRDKLVTIRGWLTIWFSQRLWRQYGDEGEICRQSLLNDILVVESYWERRTAPA
Ga0193726_100021673F003836AGGAMYAKKVFMRAWPVPAAAIIACAFFTGDVEAKDVNVSYQVGAQGLDLNQPAGARELYKRLRHAAEIVCTHGMRVDLEPTPDPQGCYEKALADAVRSVHVSLVTQAYLATHTLQQAAARGIDVPVQVAAK
Ga0193726_10002168F002473GGAGGMSLNDLPAIMGTVLIVAGLALVGVSTWSRAEGSEKTTQAGALVIVVSTFLLGLSIFVSHG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.