NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193726_1000467

Scaffold Ga0193726_1000467


Overview

Basic Information
Taxon OID3300020021 Open in IMG/M
Scaffold IDGa0193726_1000467 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42326
Total Scaffold Genes42 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (69.05%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9871Long. (o)-107.0011Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018973Metagenome / Metatranscriptome232Y
F027912Metagenome / Metatranscriptome193Y
F042990Metagenome / Metatranscriptome157Y
F044041Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0193726_100046720F044041N/AMQPAEVKALCDQLREVIAAGPGKNDLALQEATGVVSMLQQAAPWNGPRDKLVTIRSWMTIWFSQRRWRQYGDEGEICRQSLFDDILVVESYWERKTAPA
Ga0193726_100046726F018973N/AMRQLLIAGGLILALLSACASQSNKPVEYLDDRTAMTVGSLKEPIELVPRLHEGGLRVITSLTKKISFAYLGPVEWDRSGAIVYGLWVHIAPGNGHPIADIRSPTALTLVLDGGTRALTPIDAPQLGRGAYQPVASWGQTAYFELTVEMLKQMAVSEKLELDVRAADDSIMNFIATGDTRETLTGYLHSRGITDD
Ga0193726_100046732F027912GGAMLQVVDEVDDAVSALRLFAMGWSEEIGLVAAGSAAACAVCAAVLRGVA
Ga0193726_10004677F042990GAGGMDFEDRLKKLQSLFTYALSNSVTAKARYLAIAKEPGATAATIALAKMNWHQLEARKTAIIAQMVALEEMEIETA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.