NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193726_1034770

Scaffold Ga0193726_1034770


Overview

Basic Information
Taxon OID3300020021 Open in IMG/M
Scaffold IDGa0193726_1034770 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2477
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9871Long. (o)-107.0011Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004899Metagenome / Metatranscriptome419Y
F014291Metagenome / Metatranscriptome264Y

Sequences

Protein IDFamilyRBSSequence
Ga0193726_10347702F004899GGAGMLRVECHDIGDTVTFRLEGRLVREFAKDARELVTRRKSPPRLVVNLSEVTFVDGVGEDVLLWLARIGGEFVAENCYPLHVCERLHLPMAPKCARALPRAM
Ga0193726_10347704F014291GAGGVAFIQGKGSVMEWFHSTERKQLDRLQGSRASSHEIQSAFAEQRNYLYWIALLISGNDALADQAVVNASALSANYSGVFRDWLIGWAKYATVRAAVREVRDLISASASHYVDSSSEPCDDDVLSDDQIMSLRHVDPREIIAALDPLARCALVVRGIQHASLADCALLLGVSRGIVAGAYSRALRWNGEHIDAQAASTEDQLDSGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.