NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207193_1149779

Scaffold Ga0207193_1149779


Overview

Basic Information
Taxon OID3300020048 Open in IMG/M
Scaffold IDGa0207193_1149779 Open in IMG/M
Source Dataset NameMicrobial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1961
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment → Sulfate-Impacted Lake Microbial Communities From Northern Minnesota

Source Dataset Sampling Location
Location NameLake Manganika, Minnesota, USA
CoordinatesLat. (o)47.489552Long. (o)-92.573009Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F002387Metagenome / Metatranscriptome565Y
F013184Metagenome / Metatranscriptome273Y
F049617Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0207193_11497792F002387AGGAGGMASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDRFVQDEFNKFYNLKEGDEDYL
Ga0207193_11497793F013184GAGGMRSYDFVIKLAGSVMANNENEAHNKINAHLDDLGKVDSTRYDLGWPDVSWDMEYDLC
Ga0207193_11497794F001460GGAGMLGYTEEDLNRMINAIHDVKLFYLRSPSDLMNKDPLVKDLEDAVSFMQGLWAEGYFDYAN
Ga0207193_11497796F049617AGGMNSEDIGLPPHLQRLVNAGVSGLDIMHGELKNLMLIAEQDLASALEQEELSEEAMDSM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.