NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207193_1354031

Scaffold Ga0207193_1354031


Overview

Basic Information
Taxon OID3300020048 Open in IMG/M
Scaffold IDGa0207193_1354031 Open in IMG/M
Source Dataset NameMicrobial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1002
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment → Sulfate-Impacted Lake Microbial Communities From Northern Minnesota

Source Dataset Sampling Location
Location NameLake Manganika, Minnesota, USA
CoordinatesLat. (o)47.489552Long. (o)-92.573009Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F102145Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0207193_13540312F102145N/AMMVSYKIHVLKILAEKMATEKQEATETLLYNFEYPMITECGAVKITDHHVFLQFPEKPTVHVEHAVKLRRNITLYVENGQCFSLDWIPIQTVTDFFRVKEMIEKCLQSYSYLLDNKTHFSPHTFSVNPINYYESLTTGFTTNSFSLSCFEHTVDTCIQLSVINKECDKKEIPLHFQLCIGKHVVFCTERDLKCVDKAKDVHFIVQFILQKMLNISFL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.