NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194113_10091117

Scaffold Ga0194113_10091117


Overview

Basic Information
Taxon OID3300020074 Open in IMG/M
Scaffold IDGa0194113_10091117 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2711
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-6.1786Long. (o)29.658Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000808Metagenome / Metatranscriptome882Y
F003393Metagenome / Metatranscriptome489Y
F060846Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0194113_100911171F060846AGGAMSRSKAINVKIATAKVIKALETRLAKLNADFSSQDELE
Ga0194113_100911174F003393AGGCGGMRAIEKDDIIPIMDYVKADILNAGQLMVDDLIIINNEVVSIVDIQSLADGYILEIVNDFGERDHVEVAEFDQFDLMLLQ
Ga0194113_100911176F000808GGAGMDKEYTYALTTLYDGELVHTLRVSDMLTAVNAWDKCVDHGNAKEYATYNLSDPTGKMYTKTFYANGKVVIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.