NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179590_1023130

Scaffold Ga0179590_1023130


Overview

Basic Information
Taxon OID3300020140 Open in IMG/M
Scaffold IDGa0179590_1023130 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1479
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033976Metagenome / Metatranscriptome176Y
F043021Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0179590_10231302F043021GAGMQSLMLSQKILFGERSPPTPFNVVIMYEDFGSGKRAKKGLDYVAEELGNDLEFRHSMWRLDTLQDPKFNVLAAPALSEADMLIISLRGEGQLPAKIRALIDEQLAQTVNHQCALMAVFESAASATRSSVYTCLANLAWRHGLDFFEQALSDAEDHEESSLKLIWVF
Ga0179590_10231303F033976AGGAGMSFQEKSASRKKTQGDAPEILHKVSLIGLAANLDDPLYHRAIGKLSIILEELKSINATRTKQLRGSRALRRYIE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.