NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211732_1474387

Scaffold Ga0211732_1474387


Overview

Basic Information
Taxon OID3300020141 Open in IMG/M
Scaffold IDGa0211732_1474387 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7388
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)10 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003379Metagenome / Metatranscriptome490Y
F003690Metagenome / Metatranscriptome473Y
F005531Metagenome / Metatranscriptome397Y
F051930Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0211732_147438716F051930AGGAGMRVQYVSAYISMSEEGLVEKLLCPVDQSLLFSNQNLLDEVYLYCLECDYKKSLGAASYQKIVDEVNKHKNV
Ga0211732_14743872F003690GGAMIPSGFELVISNEYGLEFDSFLGAIYLPWHTMIITALSLIAYKIYKIKRGK
Ga0211732_14743874F005531AGGAMTITYSLWQGSQLLSVDNTAKNSDELLAVMTELNKLGKGFTYNVRKVEVSK
Ga0211732_14743879F003379AGGAMKKMWVGISTIAIAILSGVALSKFLNWAGNVEIFDFDLDEDIDQESNPFA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.