Scaffold Ga0194038_1001419

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194038_1001419

Scaffold Ga0194038_1001419

Overview

Basic Information
Taxon OID	3300020158 Open in IMG/M
Scaffold ID	Ga0194038_1001419 Open in IMG/M
Source Dataset Name	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10347
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location Name	Canada: Ontario
Coordinates	Lat. (^o)	49.688	Long. (^o)	-93.689	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021920	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194038_100141920	F021920	GAG	MAKVQQTSSELSRTLAGQWSKTEKRAEASRSIAAAKKSTAAKVKAFKQTQLLNK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.