NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211734_11009291

Scaffold Ga0211734_11009291


Overview

Basic Information
Taxon OID3300020159 Open in IMG/M
Scaffold IDGa0211734_11009291 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)627
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004092Metagenome / Metatranscriptome453Y

Sequences

Protein IDFamilyRBSSequence
Ga0211734_110092912F004092N/AMAKEFTVYEGKFPCKKCGVEVGSLRYWRETGDATWMCPEKHISKVNLLPPTKEDYERKKR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.