NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211734_11081596

Scaffold Ga0211734_11081596


Overview

Basic Information
Taxon OID3300020159 Open in IMG/M
Scaffold IDGa0211734_11081596 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1612
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F011938Metagenome / Metatranscriptome285Y
F013878Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0211734_110815962F000671GAGGMEKILCYSCAKSKNKLEVKRSSLLPINLLMCETCITSKFEPRWVIILAGRSNGPDHVKEFIIKKRYAGTEVSASELLI
Ga0211734_110815963F011938GGAGGVKEYYDVVHIVYIHSEKSYGSVEKLGAYASMVKYKKNDEELEELMENEDFTIMEEIIFKHIEEQD
Ga0211734_110815964F000473AGAAGMFIDKGLDKQKEHFKYGINQWTGEPNKPVFYTIEMQKKVHTIQKPPTFMMDIVKYPEFLALRLYEDNFLQFEGSKKEMVIDYVTKVKTLIESYGVRCELEGVPSERVL
Ga0211734_110815966F013878AGGMLNLTELGVEVFIKKARNVNPYWDNYDLVIWKKDSSGFTNVKGMFRNNNWGTAEKIVVNNNGIWKLPAKYVKHFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.