NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211734_11326759

Scaffold Ga0211734_11326759


Overview

Basic Information
Taxon OID3300020159 Open in IMG/M
Scaffold IDGa0211734_11326759 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7655
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027826Metagenome / Metatranscriptome193Y
F103135Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0211734_1132675912F103135GGAGMSDKEFHRLLVCKTHGVMYKMRPYEGPPEYDQELRELCDRHNAQVPNPQDCRAIIFRTDADTASKLDVETALKNELQEQDVYIRDFRDELKVDALKCFNRHNRPNQGCIDWCNDDKTIGRKTGIPKDKRQYVCMYCPAAEYYTHRQRKELGLYDK
Ga0211734_113267598F027826N/AMQVPYKPNQSHAEMLVDQALQSAISTPEQIRMIRPVVPYQLMPQSRGFSKQELSVMDVLNTPRTAVTRRSWLSGAPVMFRDGFMEGNFEGSSRYSMQGLWA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.