NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211726_10638434

Scaffold Ga0211726_10638434


Overview

Basic Information
Taxon OID3300020161 Open in IMG/M
Scaffold IDGa0211726_10638434 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5029
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)14 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009888Metagenome / Metatranscriptome311N
F024791Metagenome / Metatranscriptome204N
F058132Metagenome / Metatranscriptome135N
F097201Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0211726_106384342F009888GGAMAVIFDLTEDPQQVVQVSAWVGDWHSYVVRLVDELGSPVDITTGTLGITFTNIATGAAYSFASGSVTLTKQYSAQGILSILNPAAYPTAANIRITVSFTVGTDVRRFGPLEIEVLAP
Ga0211726_106384343F097201N/AMSVSLKKVRLDSYQRNLGKLSMAVGKAAADVQGEASKSIAMNSGKYREYYGRVEHPHWSSPPGTPPNSDSGILANSIMPQRVNATTYLVVVNAKYGVPLELGWMSKAGNHVPARPFLRPAVEYVAPSFQAAVKSILKGNN
Ga0211726_106384345F024791AGGAGMPFTRTSALIGENCVVTVAFGGYQDGTPSAFTAETYTCIARSVRFSSSVNTVDVSALCDTQNKAQVTKANGSVEVEFLVDSVVNPIFYGKDGYYCQIVVTPGTLTAKTFVGVVTGTGLNVANEEAVTESATITLGTNGVATAWS
Ga0211726_106384346F058132N/AMALQSLKQIPKDTDKGLLTVDLSDVAGDGAELRFREPKAADLFPDAKELQSLRVAFAEFPEAMLYQIYLLGRCYVPDPTDGSEESPLRAFGNLARTSKQTFFRILGEFISWYPTDDLQGRVKDAKND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.