NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206125_10004183

Scaffold Ga0206125_10004183


Overview

Basic Information
Taxon OID3300020165 Open in IMG/M
Scaffold IDGa0206125_10004183 Open in IMG/M
Source Dataset NamePelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13047
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (81.25%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameAtlantic Ocean: North Sea, Helgoland
CoordinatesLat. (o)54.1841Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003827Metagenome / Metatranscriptome466Y
F005883Metagenome / Metatranscriptome387Y
F025767Metagenome / Metatranscriptome200Y

Sequences

Protein IDFamilyRBSSequence
Ga0206125_1000418314F025767GGAMPQYRMKDTDGAEHDITCTIADMVKLKEEGWVTVFVPNPNSIISGRDTSGHGGGHGTSDGWKDVLRRIRDNNPKSTIDV
Ga0206125_1000418318F003827GAGGMAEGRWADWQVRQIAENVAEKRPKREWFKQDQEQYLTSLRSWSHITACMLSSMELEERQMIIFIHHLGMEHIGVQTFDPQDKGMTSDFRPNEGQGNKK
Ga0206125_100041834F005883GGAGGMKTQIKDLGSEGIVYRRGQQIVLENDKTGEHRAVKVIMYDSRQGWLAESSDEDWQWYRMKNEYWPKEEEYWKYIKKVGT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.