Scaffold Ga0180732_1010965

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180732_1010965

Scaffold Ga0180732_1010965

Overview

Basic Information
Taxon OID	3300020171 Open in IMG/M
Scaffold ID	Ga0180732_1010965 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_0.1 MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3625
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (41.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location
Location Name	Finland: Olkiluoto Island
Coordinates	Lat. (^o)	61.2413	Long. (^o)	21.4947	Alt. (m)		Depth (m)	420
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080857	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180732_101096510	F080857	N/A	MSENERGGETFLAIIGQGYRVTIYEPIRNSLGLDVGDRVRVTIRKDEAKG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.