NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211729_10534464

Scaffold Ga0211729_10534464


Overview

Basic Information
Taxon OID3300020172 Open in IMG/M
Scaffold IDGa0211729_10534464 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2269
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001515Metagenome / Metatranscriptome679Y
F001531Metagenome / Metatranscriptome676Y
F057906Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0211729_105344642F057906GGAGGMITYNLNTEDVSNLIKAHLCDDLQITNLDGYSVISSDSDKLYGYVIAFTTGQPVITKEDYKNILTGASDSDSTPLFIAATPDGVFQYDLSLLKLGFENYADHSAGIDVDVADLDISIGVQILEWYPEFASEDEYVDALMSGGDAIGYDESESW
Ga0211729_105344643F001531GAGMDWNRIERWEYVVTAVASEYAKKFTICEYEDIKQALYQWFAEHPNKLDTWEAIGEKDAKNLIYRSLRNEALDYCQRWKAKTVGYDVSDLYYYEPGLVEVLLPTVLMGNFHIAPKLNLSGAGGRPSAPAEGGNIQVMLLEVDSAYWKLSKEDRKILFFRHAESLDFKEIANFLSLGTEDAARMRHKRAIKRLVNKLGGRKPYLDEDIKDATETEDLPDSQEEL
Ga0211729_105344644F001515N/AGYGRKGETLVEELLTGGRTVEVKRDRKWWITNNLYIEVECWFNKSKAWEPSGLSVTEAAYWAFVLEQSTVIVPTHILKKGVLELGREISCEVPPNKSKGYLITVEDLLTMTRKYKNEKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.