NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194134_10006534

Scaffold Ga0194134_10006534


Overview

Basic Information
Taxon OID3300020179 Open in IMG/M
Scaffold IDGa0194134_10006534 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10403
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (54.84%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.8915Long. (o)29.586Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055822Metagenome / Metatranscriptome138Y
F091922Metagenome / Metatranscriptome107Y
F095362Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0194134_1000653419F095362GGAGMNIPVQKKFINWFYNKPFPNHDSKRNRNAFLDEMLKCNNITHDTIQYWVQEAFHQGAQAQRELDNEK
Ga0194134_100065345F055822AGGAGMAGYTREFLVDAYLWRFSSLDIETLLNLEKIANKTYDTYGKDKFRAYASLDAEYLRNYKANIKR
Ga0194134_100065349F091922GGAGGMSKIINYTTELEHLIVNTLLPVYEDYCKRFPLSSLVKKDIDYNILGEVKGKRDPGALLKPRKNLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.