NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196958_10001412

Scaffold Ga0196958_10001412


Overview

Basic Information
Taxon OID3300020181 Open in IMG/M
Scaffold IDGa0196958_10001412 Open in IMG/M
Source Dataset NameSoil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7664
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (54.55%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.3049Long. (o)-116.2547Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002548Metagenome / Metatranscriptome549Y
F092677Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0196958_1000141210F092677GAGMRVFPNVFACAALLALACGGQPPRDHQAEWRDVLRHKAAAVSPGATPEQKQAYADSVRAFVEKHPDHSRAQQVWLRLQLEFADDLAAVGRHRDAIRFYRGVLVRHPENEDARRGLARAADRIAIGRDKLLTLEKGMSHRQVAHLLGKPLPGWTVENRRGGTTFEAWYYRTRTGSIAGVYFRDGRVFAAEEASNARLGRLGS
Ga0196958_100014127F002548N/AMPKFEYESHSEPGSLPMERRRLRRVRMIVELTLNLISSDRTASHREARCLVDCARKAILELVPAFESRYERIVRPYFERVLQQRWPEEELRYSDPFETVN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.