NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211731_10976280

Scaffold Ga0211731_10976280


Overview

Basic Information
Taxon OID3300020205 Open in IMG/M
Scaffold IDGa0211731_10976280 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4602
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000903Metagenome / Metatranscriptome843Y
F002433Metagenome / Metatranscriptome559Y
F009883Metagenome / Metatranscriptome311Y

Sequences

Protein IDFamilyRBSSequence
Ga0211731_109762804F000903GAGMITHLDEVLCMVQAIQHCTNRPADHPMRFQRNLSWFEYVAQMAESMAAEWLVARTLGYDYSPGITWDKSKADVGNNIEVKWSANPNGNLWIQDSDRHDRDIAVLVTGQQSKMKIIGWIPVAIAKKPRYRNASQNNWPVPQVNLQPIETLQRSNYAHPSL
Ga0211731_109762807F009883GGAGMNELSIVIFMVIAGALWAVMAYSVGFKQGEREGFLKGRAISRHASSRVNS
Ga0211731_109762808F002433N/AVSVGEWTAVGGLVIAILAAIYSSMRVIVRSIMSELSPNSGSSLKDQVSRIEARLDHLYTKLIDSDHKII
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.