NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211731_11617148

Scaffold Ga0211731_11617148


Overview

Basic Information
Taxon OID3300020205 Open in IMG/M
Scaffold IDGa0211731_11617148 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1116
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F000645Metagenome / Metatranscriptome962Y
F004115Metagenome / Metatranscriptome452Y

Sequences

Protein IDFamilyRBSSequence
Ga0211731_116171481F004115N/ATRNHNSNQYCDLCKYRWGQNKNGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINEFAGREKLDVKLP
Ga0211731_116171482F000645GAGMSSYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVANCDVYIIKTELYRTEADAHPWTTGLSSESKSKQYALELAETGSLGRALNLAGYFAKINQSPKKAIETTKPALAEFIKEQRPNDPDPIVWDVTAVADALGAEIIDELPLCSNGCGPMILKQGTKEGKEYRGWVCPVPKSGHPAKWMRVGSDGHWVFQK
Ga0211731_116171483F000545N/AVDESWFRWALGISEMRSDAHPFICSGCKLVTPHIELHKYDSSEIAEAPEEVWLVECQRCFMQRIIYPSDRVTAKEDDIVRCDQCGKWKMKAAKCRICRLAAGLES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.