Scaffold Ga0212167_1199272

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212167_1199272

Scaffold Ga0212167_1199272

Overview

Basic Information
Taxon OID	3300020230 Open in IMG/M
Scaffold ID	Ga0212167_1199272 Open in IMG/M
Source Dataset Name	Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	JGI facility at Oak Ridge National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1999
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location
Location Name	Mariana Trench, Pacific Ocean
Coordinates	Lat. (^o)	12.63117	Long. (^o)	144.72149	Alt. (m)		Depth (m)	6844
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048324	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212167_11992722	F048324	GGAG	MKKYIFAVLMLSLASACEPQPTSVADIDFEKLEGMQAECAKRAASAAMESFSDDTEWTDLLSVEGAAEAVAAITDATQLELQSCITDIYLMGIEDGRVLERDVY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.