Scaffold Ga0212168_1229518

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212168_1229518

Scaffold Ga0212168_1229518

Overview

Basic Information
Taxon OID	3300020231 Open in IMG/M
Scaffold ID	Ga0212168_1229518 Open in IMG/M
Source Dataset Name	Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	JGI facility at Oak Ridge National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1147
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location
Location Name	Mariana Trench, Pacific Ocean
Coordinates	Lat. (^o)	12.47649	Long. (^o)	144.86485	Alt. (m)		Depth (m)	7939
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028812	Metagenome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212168_12295181	F028812	N/A	MDPDLETVIWQAPGVAKAAGRDDMGQTMIAVQAVQQARPDMTAADALAAVNLVQREMIPSRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.