Scaffold Ga0211654_1013062

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211654_1013062

Scaffold Ga0211654_1013062

Overview

Basic Information
Taxon OID	3300020247 Open in IMG/M
Scaffold ID	Ga0211654_1013062 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1359
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_102
Coordinates	Lat. (^o)	-5.2476	Long. (^o)	-85.3343	Alt. (m)		Depth (m)	40
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014191	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211654_10130622	F014191	AGGAG	MDLSFITADLLNDVSWFDGIIYIILGLVVYAAIRYINKKI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.