NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211671_1019979

Scaffold Ga0211671_1019979


Overview

Basic Information
Taxon OID3300020270 Open in IMG/M
Scaffold IDGa0211671_1019979 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1324
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_098
CoordinatesLat. (o)-25.859Long. (o)-111.6989Alt. (m)Depth (m)188
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001026Metagenome / Metatranscriptome802Y
F005533Metagenome / Metatranscriptome397Y
F014025Metagenome / Metatranscriptome266Y

Sequences

Protein IDFamilyRBSSequence
Ga0211671_10199791F005533AGGAGMSYTKNEIALETFISNTNNQFYYIGEEDDKVAPIDVKKFTEYCVAFIDSL
Ga0211671_10199793F014025AGGAMNLDNYDLSTIHYALFYYMDNANLDEDEMEWIGLLREKVDSIMVSQMNYDMECG
Ga0211671_10199794F001026AGGAGMMHTLKLDDLELTALITHLEGHSEVMCESRLNSSYPDEQPDREEVLLNLVYEKAFTIGWDNHINPKVDFNLHQNEDRIYKYK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.