Scaffold Ga0211658_1113130

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211658_1113130

Scaffold Ga0211658_1113130

Overview

Basic Information
Taxon OID	3300020274 Open in IMG/M
Scaffold ID	Ga0211658_1113130 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	528
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_102
Coordinates	Lat. (^o)	-5.254	Long. (^o)	-85.2248	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096285	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211658_11131302	F096285	GGA	MNWLKTAAIGIWIRAHSDLLFRAIVSLGIFWIMNSVYSKYEAVLLATNPEKLFIPLYIYTFIILALVIWTLLALRWVSGMAVAKKKVAAKESFTN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.