NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211483_10000992

Scaffold Ga0211483_10000992


Overview

Basic Information
Taxon OID3300020281 Open in IMG/M
Scaffold IDGa0211483_10000992 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10919
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (61.11%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_032
CoordinatesLat. (o)23.4017Long. (o)37.2183Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003693Metagenome / Metatranscriptome473Y
F060970Metagenome132N

Sequences

Protein IDFamilyRBSSequence
Ga0211483_1000099211F060970N/AMNMNGIGYPLMTQNNGYTNKEMLHIIKEDVQNLHKRIDYLHEKINKSPTRAEIVGWLVGLSSTAAFLNTIM
Ga0211483_100009922F003693AGGMIRSKLALIDVSEDNNDSLAVKTDGMLLCGVEFPAAMTGSAITFDFSMNGSTGWVDVFETDGTEVSYTVSAGNMVRVDPSGWAFASNGYLRVSSNGTEAADRNIVLHFRHS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.