NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211520_1000065

Scaffold Ga0211520_1000065


Overview

Basic Information
Taxon OID3300020294 Open in IMG/M
Scaffold IDGa0211520_1000065 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24663
Total Scaffold Genes58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)42 (72.41%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_025
CoordinatesLat. (o)39.3757Long. (o)19.4167Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003834Metagenome / Metatranscriptome466N
F011522Metagenome / Metatranscriptome290Y
F026154Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0211520_100006523F011522N/AMKNPERYLFRAIISQAIHDAMYNGLDKYYLIDKRNAIDWLISNSVDFRTICHYAEIDPEMACKKFTAAMKLDLYTLREDQHKVLSKPRKKYKHKSKFRLTFNEQSLEQTD
Ga0211520_100006541F003834AGGAMSSSKTPIRQDEKDYLDHFIETKYDDRKNVLKTEMQDTIDKEAEDNFEAFKDKLKISKMHDEVRTLYEDHKKFANEMDSILLEKKGKLDNAINVLEDKLDQWKKIRKWKNDIERSLIKEPDELDRLLKKLCHEETERDYYSGPRGKAIQMLDMSKEYCKNLLNAGQSLSTVWGVLDQEMGKEKINTNTIPKPEFLAITK
Ga0211520_100006544F026154AGGAMNGIITVIRFVTYTIGGIAIRKSWNWLTTDVDPIPYTKEFEEEYAQTKAKYIRLTKLKEKHDAYRKNRRTIS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.