NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211474_1007069

Scaffold Ga0211474_1007069


Overview

Basic Information
Taxon OID3300020296 Open in IMG/M
Scaffold IDGa0211474_1007069 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2249
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_018
CoordinatesLat. (o)35.7392Long. (o)14.3321Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000720Metagenome / Metatranscriptome923Y
F009812Metagenome312Y

Sequences

Protein IDFamilyRBSSequence
Ga0211474_10070694F000720GAGGMSLIKENEKVRRQIPNRMPSATFALPIDGRKVVGIVNYDVTDTGIIPMAFWVKLKPTDSYLDRELRASGKLISRCLQNNESLKDLVDTLSQDNVIGQMANYLYKNMEDIIMGKQPEKKQRELSTDPYAMKE
Ga0211474_10070697F009812GGAMTDDELEFEIEWIPEDTGAPYEAEDEVFPDVPSHTLDKWCQEKYGHTNWVRMGMMSPTDLVGNPCEFDYINGVIYFKNKILV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.