NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211684_1006700

Scaffold Ga0211684_1006700


Overview

Basic Information
Taxon OID3300020304 Open in IMG/M
Scaffold IDGa0211684_1006700 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000787 (ERX556110-ERR599176)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1819
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Polaribacter → Polaribacter filamentus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_085
CoordinatesLat. (o)-62.1363Long. (o)-49.3331Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017725Metagenome / Metatranscriptome239N
F041864Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0211684_10067001F041864N/ATHRSFVIEFNNNIDRISMLIHFKHLSIHNLTLHYRKKSARNRKTQKVYPQHKMNLFFENTLELLTYLSSKNYKVDWIEIRFKNGWAIKNAMLNELEFITNNTQERNLLFEKLISLSGQGPIDINSLEINETYSLCTDGEVKLKPLFS
Ga0211684_10067003F017725N/AMNDFKINLSFEHRLYLNKDAGTLTHVFGEGYFITDEYGREVNTLLQEKEFDRLIEKFKYRQLLIEKLNKELKDSFDFGEDNLLLINGKRVAKRYWSIPKNEVEVDLFFKIISEEFNS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.