NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211517_1000084

Scaffold Ga0211517_1000084


Overview

Basic Information
Taxon OID3300020319 Open in IMG/M
Scaffold IDGa0211517_1000084 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18784
Total Scaffold Genes33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (69.70%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_018
CoordinatesLat. (o)35.7593Long. (o)14.3453Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007621Metagenome / Metatranscriptome348Y
F017755Metagenome / Metatranscriptome239Y
F031294Metagenome183N

Sequences

Protein IDFamilyRBSSequence
Ga0211517_100008431F007621AGGAMPKSISKTPVVNNTLESEGKALATIWKGIVKGNFDNATKAEGFDTRLGKLMLALKAEGGQRISTDRLKDCGINGIDKRRRSEALWFVENEKACRDFVAKSKKGFKSLTALQAAMKPKAPSKPKADTETPVEPKADDKSNVGLDSEADKAETKSASDIALEALVQCELNGVSKAKFLAALKEQLEMLDDSTDKSVIKDDAGNVYVAAA
Ga0211517_100008432F031294N/AMLQSNLLGDIQMKFEMLDLFLIAMLMVAIFFGLAMLSLHGIGYMTWLSWTMFGCSAWCLVCGWGIVAYNLEKRNG
Ga0211517_100008433F017755GGAGMARKFITPMGKHKPVRSSWAAMDTQAYSRSYEPETRPEFRVYVTGQADAMLDTYRKAKDKADALAILDSLL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.