NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211510_1016346

Scaffold Ga0211510_1016346


Overview

Basic Information
Taxon OID3300020336 Open in IMG/M
Scaffold IDGa0211510_1016346 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1976
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_023
CoordinatesLat. (o)42.1659Long. (o)17.7285Alt. (m)Depth (m)55
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003769Metagenome / Metatranscriptome469Y
F005578Metagenome / Metatranscriptome396Y
F011629Metagenome / Metatranscriptome289N

Sequences

Protein IDFamilyRBSSequence
Ga0211510_10163462F003769AGGGGGMQQLKTLTVKTSNKVESVHMDTLYVVINNCFNNLNVVEADCTSASYYINSANIFAQLQMLYCENESNDYVSLQSVMEVFANNITYYDESSLFTQVVKNTAMQNVKLENYVYLSN
Ga0211510_10163463F011629GAGGMLNTTQVKELVKQRFGGSLKQAYLNKCYSNKQEIADKRNMAFAVDGDAYKGVDLTALAQEIGCKRVKLHTAFLRGMQSGAWLRLQHVSYNK
Ga0211510_10163464F005578GAGGMQKNINTRELKHLCNFLTHAMNYKVELVSDEDFACDEDGGANIYDWVSATEELCMRTQCVLDNYFTHKDETLATAFETAIDYRYDDDCINEGISEHFFDYCKKHNILDFYFKQADAHDYDGEDANMRMYKS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.