NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211613_1002927

Scaffold Ga0211613_1002927


Overview

Basic Information
Taxon OID3300020353 Open in IMG/M
Scaffold IDGa0211613_1002927 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3990
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_123
CoordinatesLat. (o)-8.896Long. (o)-140.2861Alt. (m)Depth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007004Metagenome / Metatranscriptome360Y
F009987Metagenome / Metatranscriptome310Y
F052862Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0211613_10029272F052862AGGAVEDNEKQSRESQTQILELQKDIEHLNYILKELDKDKEFLKEHFTLKNSQRLEDIAKLHSRLDKHIQTELEYHQSVRDKATVEHAAIHKRINQAERWIWIFFGGFTVVGALLGKASFTSIF
Ga0211613_10029273F007004GGAMKNIMLGFCLIVLIGCGATSNAYKRPDVRIVGEAQMKKLENGNYEVTPRWIKDRFDAENSMLKQLEDCREGGR
Ga0211613_10029275F009987GGAGMISLIGNALGLGLKIMDRIEKNSDKPSFEEFKGRKKEMDNSLADEDVNGIDSMFEYLAERARAGKTGKKG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.