Basic Information | |
---|---|
Taxon OID | 3300020360 Open in IMG/M |
Scaffold ID | Ga0211712_10001480 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX555918-ERR599165) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8114 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_070 | |||||||
Coordinates | Lat. (o) | -20.3976 | Long. (o) | -3.2009 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016591 | Metagenome / Metatranscriptome | 246 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211712_100014801 | F016591 | N/A | ITIIRIATPNMIPRKEKIEIIFKKPSFFLGLKFLNEISLSAFVNNVLTF |
⦗Top⦘ |