NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211703_10198638

Scaffold Ga0211703_10198638


Overview

Basic Information
Taxon OID3300020367 Open in IMG/M
Scaffold IDGa0211703_10198638 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)525
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_072
CoordinatesLat. (o)-8.7887Long. (o)-17.9142Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071291Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0211703_101986381F071291N/AWGNTHRRQPPSNWRNSQANASIYILWVAKEPNTNLNSNSDGTLKPNTHHERWLNAYCSIGISLGLTMRAAVKMGFKTGANKNHNDLNGNDFWEKRLGILDEVKAGTKRITYGLGIGYPQENKPRYESDDTELMIGASNGSKLTTTGQDIHKPSGMKARKVKLVNIKGNENKTIE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.