NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211477_10000300

Scaffold Ga0211477_10000300


Overview

Basic Information
Taxon OID3300020374 Open in IMG/M
Scaffold IDGa0211477_10000300 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30916
Total Scaffold Genes64 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)51 (79.69%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_030
CoordinatesLat. (o)33.93Long. (o)32.7322Alt. (m)Depth (m)70
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005619Metagenome / Metatranscriptome395Y
F013594Metagenome / Metatranscriptome270N
F073584Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0211477_1000030050F005619N/AMSKEYKKENYPEGTSRKDVLDNIIDHDDIRLIVLKQFNYMRINGINLVQDADDLVNLYLKISKDFK
Ga0211477_1000030059F073584AGGAGLGKIKTDELEERVGSAGITVNSTVKVDTITEKTSNAGVTIEGVTLKDGSIVGAVDIGLVIALG
Ga0211477_1000030061F013594GGAMSTTYGDRPLRVTFTSSDSSGVAEFFDGSETGAIGITVPRFSTTERNALTASTVKQGMIIFNETDGKMQVYTGSDASNTSSSWTDIGGGTILADADGNTNIEIGATTADEIDVDIAGTKIATFDAAGLAIETGAVGVRHNSTVAATATIASGETLGLFGEVTFTGIVTVAGEMVIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.