NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211477_10021645

Scaffold Ga0211477_10021645


Overview

Basic Information
Taxon OID3300020374 Open in IMG/M
Scaffold IDGa0211477_10021645 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2852
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_030
CoordinatesLat. (o)33.93Long. (o)32.7322Alt. (m)Depth (m)70
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002093Metagenome / Metatranscriptome594Y
F005720Metagenome / Metatranscriptome392Y
F049044Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
Ga0211477_100216452F002093AGGAGGMAYDGTIPAGGPGNFQTPNLAHEGEGVRVDFITVDYINAMNGEVTHSTASANTAGLKLSMEAIQNQGVNILAHGALGNSNTEQTYMVRADALDTISSTTTVAAIQAAIRGLNALTPDKVTANISSATAGDRDLSDTQVA
Ga0211477_100216453F049044AGGAGGMAYDGSKVAGGKGNFSLNQNFDVEGVDITLLTVDFIVDMSAETGDLTTGSTTAGLQMTRHAFEHQGLRILAEGPLVDSNTQKTYMVRTDQLDSLSGTTTKAALQAYIRTLDQSSSSFPGIAADVTGATVTETKIGILTANAVS
Ga0211477_100216454F005720N/AMSRRQSFNGKGLTFIEMMFDDEVTTTATTPDTKDSVFNDMSKLVGTFGTIIAQSYTLAAKATEKDAALATSIVEDELCDYYTFIVEGTPGQFNKADSTGDINLDPGQNETSDPGVIADAEADIEAEILDRISGSSDSAEGVHVDVRFLPSDGVVSTGVDEVYGVNSARVNA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.