NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211682_10009386

Scaffold Ga0211682_10009386


Overview

Basic Information
Taxon OID3300020376 Open in IMG/M
Scaffold IDGa0211682_10009386 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4097
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_085
CoordinatesLat. (o)-62.2658Long. (o)-49.1658Alt. (m)Depth (m)90
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023453Metagenome / Metatranscriptome210Y
F038861Metagenome / Metatranscriptome165N
F099871Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0211682_1000938610F023453N/AFEEGTSAEKLSKSLIQRAMDKFKKQPAPTDEKTKEMEDYMAQLEHMLGKEEEVEKSTLKKFFGFFRSHPRMIGLGVMILMLLSPMLPSIAIIGLSLEKILSITLAGLYAIDIASPAVKTALEI
Ga0211682_100093864F099871GGAGMNFIKFTFTAFDKEYVVHCDNAVSTDIDILNEKSKALEKANREFLDKFLKEDIDPYPGWWMESSATDFYWNVGNNFD
Ga0211682_100093868F038861GGAMSNWVKYETPHKGVGMFVSVWIDKDNGLIKRIFNGDHCGEGRVRMTNKADILFKNEMYWLTHPELSESKFLPELISIDIDTRTIVQKYYGPNLLDYLHDPKGFPVPNISEQILEMYTLFTKVGVNKLNGALSNLSFNGDQVIAFDFKWARPAPKANAKEINAFRKWFTKIDPDLVEKLIKMKTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.