NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211652_10032062

Scaffold Ga0211652_10032062


Overview

Basic Information
Taxon OID3300020379 Open in IMG/M
Scaffold IDGa0211652_10032062 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1575
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_102
CoordinatesLat. (o)-5.2476Long. (o)-85.3343Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009691Metagenome / Metatranscriptome314Y
F015105Metagenome / Metatranscriptome257Y
F034959Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0211652_100320623F015105AGGAGGMDLQSRKANMVYEIASLINDDPLSAPVLIEELVDIMFDEQIDHIEDVIVNHFGVEVYGEETVELLSQD
Ga0211652_100320625F009691GGAGGMTSTLNSKDYVTFARRFVKETVNTMDIEELRSLVTNQIHEEIQEGENTYGQSGAFDEMIAWNEDVFLDVAKDFNLELEGV
Ga0211652_100320627F034959AGGAGGMQIDLNKEQLELLKYAVLWYECNDEEEERVIAELEEKLYNAQENDLLRTF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.