Scaffold Ga0211677_10029591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211677_10029591

Scaffold Ga0211677_10029591

Overview

Basic Information
Taxon OID	3300020385 Open in IMG/M
Scaffold ID	Ga0211677_10029591 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2646
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_093
Coordinates	Lat. (^o)	-33.832	Long. (^o)	-73.0366	Alt. (m)		Depth (m)	35
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044797	Metagenome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211677_100295916	F044797	GAG	VAVLARLTCSKTRYLMMNRELKVGHMLFTVNVKDGLATWSVKPSEAVENKHTKVLFSGIVTEEMGEELYKLSWVIRLAEDEAKGKTNE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.