Basic Information | |
---|---|
Taxon OID | 3300020390 Open in IMG/M |
Scaffold ID | Ga0211555_10011501 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100002049 (ERX555953-ERR598985) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3537 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_142 | |||||||
Coordinates | Lat. (o) | 25.6405 | Long. (o) | -88.4085 | Alt. (m) | Depth (m) | 640 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092225 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211555_100115011 | F092225 | N/A | ATAPAFLATSAGTYSEYKVMSIIKTGADFTLSLADLPTTNDMVLSRITGYECKVSRALKEGIEYICKDVKIHPPTNTTIDNDEKK |
⦗Top⦘ |