Scaffold Ga0211637_10000520

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211637_10000520

Scaffold Ga0211637_10000520

Overview

Basic Information
Taxon OID	3300020398 Open in IMG/M
Scaffold ID	Ga0211637_10000520 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	23957
Total Scaffold Genes	51 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	48 (94.12%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_112
Coordinates	Lat. (^o)	-23.1719	Long. (^o)	-129.6713	Alt. (m)		Depth (m)	696
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059068	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211637_1000052034	F059068	GGA	MTYDIDWISECCEAEPFGELDMSTINHGGPSGFCNRCLENCIFVPSQDPGDPFDTREEKNGER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.