NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211575_10000347

Scaffold Ga0211575_10000347


Overview

Basic Information
Taxon OID3300020407 Open in IMG/M
Scaffold IDGa0211575_10000347 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22726
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (90.91%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_133
CoordinatesLat. (o)35.3379Long. (o)-127.7376Alt. (m)Depth (m)650
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051480Metagenome / Metatranscriptome144Y
F068149Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0211575_1000034715F068149GAGMTLDEFQIKFLKFAEESVEPLKGDGYPVCPYAKSARIKEALQFIDAREDITVLESFDHIKYQMAIAWLGDVDDMSSIEKTCEELREKHPHLLYFTSTRTSGHFVKNFTDCVFVQRKSDLLEKRKHLHNNTTYYDSWPKDYYNLIMGH
Ga0211575_1000034716F051480N/ALWTYLENWRRLRCRKFFRGLIASRQPEEIAKLIEKYEKDLKITEGSYLDIVIRSEGAFSYKDIMEMPVNSIQMLIERMNNRVDEQNKANKAAMSKR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.