Basic Information | |
---|---|
Taxon OID | 3300020417 Open in IMG/M |
Scaffold ID | Ga0211528_10116654 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1070 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_038 | |||||||
Coordinates | Lat. (o) | 19.0108 | Long. (o) | 64.532 | Alt. (m) | Depth (m) | 25 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F064213 | Metagenome | 129 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211528_101166541 | F064213 | GGAGG | MDNIVNNYWVSSWIEVCVCEDEGKRRFVVVNTDSGIEEDISEWAAKAMCMTPDSTITPENWEDFCTASGYFCEDN |
⦗Top⦘ |