NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211565_10012706

Scaffold Ga0211565_10012706


Overview

Basic Information
Taxon OID3300020433 Open in IMG/M
Scaffold IDGa0211565_10012706 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3568
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_138
CoordinatesLat. (o)6.3315Long. (o)-102.9484Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002883Metagenome / Metatranscriptome523Y
F039683Metagenome / Metatranscriptome163N
F099446Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0211565_1001270610F099446GAGMTTAFKKELYNEDLVYSSVVFGMGFWIDDQGLFLSAPEFQDGSLDIDNMGAVYDWENWDELSAHHLSHLMHVNQMCILKRDTQQIEYFSTLFTKEVKNV
Ga0211565_100127062F039683AGGAGGMNYDEILKCYEGHTELHANTSFEFGLMNDLYWCLFRDHDLLEHAVPVQ
Ga0211565_100127064F002883GGAGGMSTLHHEDLLWQIFEEVQEAFPYYDEEKQIEIANNRFQDMCQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.