NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211565_10028594

Scaffold Ga0211565_10028594


Overview

Basic Information
Taxon OID3300020433 Open in IMG/M
Scaffold IDGa0211565_10028594 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2357
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_138
CoordinatesLat. (o)6.3315Long. (o)-102.9484Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000613Metagenome / Metatranscriptome985Y
F002192Metagenome / Metatranscriptome585Y

Sequences

Protein IDFamilyRBSSequence
Ga0211565_100285942F000613AGGAGMPLVKKRLSVAAGATSDQVLAGTTYEYVDPGTRIVVAAAVDTVGSATADTTMDFTVNNAEFSKNASVSAIVTGEPFGWNGNYVMNDMVTTGQVRNRPVITFTNNTAATRTIDVAVFIGG
Ga0211565_100285944F002192N/AMVLLYSSSFIAFFALIVGFYACGRVAKINHATKDLDWDAVANMTGDLATTKRTIQTLNNRINGMHSPKVAEQELMMQLLSNQQNKSNGQLKGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.