NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211639_10428567

Scaffold Ga0211639_10428567


Overview

Basic Information
Taxon OID3300020435 Open in IMG/M
Scaffold IDGa0211639_10428567 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000586 (ERX556070-ERR599086)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)544
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_111
CoordinatesLat. (o)-16.9727Long. (o)-100.6633Alt. (m)Depth (m)350
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009404Metagenome / Metatranscriptome318Y
F041259Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0211639_104285671F041259GAGGMNKSRVARDLWRKVFSDNLIDLRNSDQRKQVVSEFLNDPVNSKAGWKKKDSRFFRLAFSKVARENNFQPMSVGVTPTPSRSKTKKGSMSFNVKSKE
Ga0211639_104285672F009404AGGAGGMSSEVETVQPKGEAVVKFCPISGEEFDETVLTNRWLRCDSCDSVFMIKVKIED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.